PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN01242.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 479aa    MW: 52553.2 Da    PI: 8.3471
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN01242.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.14.6e-39132191261
      zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                 ++k l+cprC+s++tkfCyynny+++qPr+fCk C+ryWt+GG++rnvPvG+grrknk++
  KHN01242.1 132 PDKVLPCPRCNSMDTKFCYYNNYNVNQPRHFCKHCQRYWTAGGTMRNVPVGAGRRKNKNT 191
                 78999*****************************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-30130189IPR003851Zinc finger, Dof-type
PfamPF027015.9E-32133190IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.733136190IPR003851Zinc finger, Dof-type
PROSITE patternPS013610138174IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 479 aa     Download sequence    Send to blast
MSEVVIKDSA IKLFGRTISL PRNTKNEVSP DEPAPPEDSS SSFPREVSST TEYDAGDKKP  60
SRKELTSTQE DVEASHQTLE ETKSPTSSSC NLENPKTPST ERETSILKSF KNGHQSDTTT  120
TCPSQDKTPK KPDKVLPCPR CNSMDTKFCY YNNYNVNQPR HFCKHCQRYW TAGGTMRNVP  180
VGAGRRKNKN TPSVSHFRQI MVPEGLQNGS LHGAVLTFGS DSPLCDSMAS VLSLAEKTTQ  240
NGVLNGFHSP NTNTITSNKG DEYYDTVMGS TLSEKRHNAT TSTNSHEKSL DNHKSYHHQG  300
FTPQLCFPGS SSSSPWPYPW NPTKTPSAFC NPVPFYTTQA FWGCMPPPSW SVNYQSAPSS  360
GPNSPTLGKH SRDGDILFQK PSTDMAENNN NNNTVLIPKT LRIDDPTEAA KSSIWSTLGI  420
KNEKGNSLNG GGLFKAFASK GSSDEKKNNH VMMVEASLSP VLQANPAALS RSLVFHERT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006573116.10.0PREDICTED: cyclic dof factor 1-like
TrEMBLA0A0B2P0Q90.0A0A0B2P0Q9_GLYSO; Dof zinc finger protein DOF3.3
TrEMBLK7K1V70.0K7K1V7_SOYBN; Uncharacterized protein
STRINGGLYMA01G05960.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62534147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47500.13e-74cycling DOF factor 3
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]